PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G00910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 338aa    MW: 37234.4 Da    PI: 8.2957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G00910.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-1659106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  LPERR02G00910.1  59 KGLWSPEEDQRLRDYIVKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 106
                      678*******************************************97 PP

2Myb_DNA-binding52.61e-16112157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE+++ +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  LPERR02G00910.1 112 RGMFSQEEEDIVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 157
                      788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.78554106IPR017930Myb domain
SuperFamilySSF466894.4E-2956153IPR009057Homeodomain-like
SMARTSM007177.8E-1258108IPR001005SANT/Myb domain
PfamPF002492.3E-1459106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2260113IPR009057Homeodomain-like
CDDcd001677.61E-1162106No hitNo description
PROSITE profilePS5129425.69107161IPR017930Myb domain
SMARTSM007172.2E-15111159IPR001005SANT/Myb domain
PfamPF002495.4E-15112157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-25114161IPR009057Homeodomain-like
CDDcd001671.23E-12115157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVLKGLAQVC YCNHSSYSEF QTNIQEEQQK EEEKFREGRK KRRAMGCRSC DKPKMNYRKG  60
LWSPEEDQRL RDYIVKHGLG CWSAVPAKAG LQRNGKSCRL RWINYLRPGL KRGMFSQEEE  120
DIVINLQAKL GNKWSQIAMH LPGRTDNEVK NYWNSYLKKR VMQAQGSIPN NLSANEVTSM  180
STTDPSSLHH HHHHQIKNSS GSTTTSHDQD ANLSSGGSHG GCISAPALAV TTAANEPFDH  240
QHQQHKSFVF SGDWMAAAAA APESYSMSAQ HWPASTASSG NVTPSHAGAF GDQMSGSYGA  300
LQQQNSAAAT MAGGGYFDLL NMGDIYGGFA ATNDDLLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-255316123128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686641e-122AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646780.11e-170PREDICTED: transcription factor LAF1-like
SwissprotQ8LPH65e-57MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0D9VBB00.0A0A0D9VBB0_9ORYZ; Uncharacterized protein
STRINGOB02G10930.11e-170(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122962735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-59myb domain protein 86